![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.55: PH domain-like [50728] (1 superfamily) |
![]() | Superfamily b.55.1: PH domain-like [50729] (5 families) ![]() |
![]() | Family b.55.1.3: Ran-binding domain of nuclear pore complex protein Nup358 [50764] (1 protein) |
![]() | Protein Ran-binding domain of nuclear pore complex protein Nup358 [50765] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50766] (1 PDB entry) |
![]() | Domain d1rrpb_: 1rrp B: [26995] Other proteins in same PDB: d1rrpa_, d1rrpc_ |
PDB Entry: 1rrp (more details), 2.96 Å
SCOP Domain Sequences for d1rrpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrpb_ b.55.1.3 (B:) Ran-binding domain of nuclear pore complex protein Nup358 {Human (Homo sapiens)} hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee aalfkckfeeaqsi
Timeline for d1rrpb_: