SCOP 1.55: Domain d1rrpb_: 1rrp B:

Lineage for d1rrpb_ (1rrp B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)

4. Superfamily b.55.1: PH domain-like [50729] (5 families)

5. Family b.55.1.3: Ran-binding domain of nuclear pore complex protein Nup358 [50764] (1 protein)

6. Protein Ran-binding domain of nuclear pore complex protein Nup358 [50765] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50766] (1 PDB entry)

8. Domain d1rrpb_: 1rrp B: [26995]
   Other proteins in same PDB: d1rrpa_, d1rrpc_

Details for d1rrpb_

PDB Entry: 1rrp, 2.96 Å

PDB Description: structure of the ran-gppnhp-ranbd1 complex

SCOP Domain Sequences for d1rrpb_:

Sequence; same for both SEQRES and ATOM records:

>d1rrpb_ b.55.1.3 (B:) Ran-binding domain of nuclear pore complex protein Nup358 {Human (Homo sapiens)}
hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
aalfkckfeeaqsi

Timeline for d1rrpb_:

• d1rrpb_ appears in SCOP 1.57
  
• d1rrpb_ appears in the current release, SCOPe 2.08