Lineage for d4us0s_ (4us0 S:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745076Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 1745077Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 1745078Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 1745094Protein automated matches [269917] (1 species)
    not a true protein
  7. 1745095Species Homo sapiens [TaxId:9606] [269918] (9 PDB entries)
  8. 1745096Domain d4us0s_: 4us0 S: [269933]
    Other proteins in same PDB: d4us0r_
    automated match to d1nvus_
    complexed with neq

Details for d4us0s_

PDB Entry: 4us0 (more details), 2.17 Å

PDB Description: the crystal structure of h-ras and sos in complex with ligands
PDB Compounds: (S:) Son of sevenless homolog 1

SCOPe Domain Sequences for d4us0s_:

Sequence, based on SEQRES records: (download)

>d4us0s_ a.117.1.1 (S:) automated matches {Homo sapiens [TaxId: 9606]}
mrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvrt
flttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvq
lrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiardn
gpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvg
svwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqeln
nfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppc
vpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesd
ikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

Sequence, based on observed residues (ATOM records): (download)

>d4us0s_ a.117.1.1 (S:) automated matches {Homo sapiens [TaxId: 9606]}
mrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvrt
flttyrsfckpqellsliierfeipepelsaelkrfrkeyiqpvqlrvlnvcrhwvehhf
ydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiafqsspptvewhisrpghi
etfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkmirhttnl
tlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvyrldhtfe
qipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegnpevlkrh
gkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekeftdylfn
ksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d4us0s_:

Click to download the PDB-style file with coordinates for d4us0s_.
(The format of our PDB-style files is described here.)

Timeline for d4us0s_: