Lineage for d1shca_ (1shc A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16243Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 16244Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 16302Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (4 proteins)
  6. 16314Protein Shc adaptor protein [50760] (1 species)
  7. 16315Species Human (Homo sapiens) [TaxId:9606] [50761] (1 PDB entry)
  8. 16316Domain d1shca_: 1shc A: [26992]

Details for d1shca_

PDB Entry: 1shc (more details)

PDB Description: shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure

SCOP Domain Sequences for d1shca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shca_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens)}
gshmgqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfn
trtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstssln
lmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvis
tigqafelrfkqylr

SCOP Domain Coordinates for d1shca_:

Click to download the PDB-style file with coordinates for d1shca_.
(The format of our PDB-style files is described here.)

Timeline for d1shca_: