Lineage for d1shca_ (1shc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803418Protein Shc adaptor protein [50760] (1 species)
  7. 2803419Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries)
  8. 2803422Domain d1shca_: 1shc A: [26992]
    has additional insertions and/or extensions that are not grouped together

Details for d1shca_

PDB Entry: 1shc (more details)

PDB Description: shc ptb domain complexed with a trka receptor phosphopeptide, nmr, minimized average structure
PDB Compounds: (A:) shc

SCOPe Domain Sequences for d1shca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shca_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
gshmgqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfn
trtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagmpitltvstssln
lmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilecpeglaqdvis
tigqafelrfkqylr

SCOPe Domain Coordinates for d1shca_:

Click to download the PDB-style file with coordinates for d1shca_.
(The format of our PDB-style files is described here.)

Timeline for d1shca_: