Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d4u3xc_: 4u3x C: [269913] Other proteins in same PDB: d4u3xb_, d4u3xd_ automated match to d1ohqa_ complexed with edo |
PDB Entry: 4u3x (more details), 2.26 Å
SCOPe Domain Sequences for d4u3xc_:
Sequence, based on SEQRES records: (download)
>d4u3xc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqllesggglvqpggslrlscaasgfrfdaedmgwvrqapgkglewvssiygpsgstyya dsvkgrftisrdnskntlylqmnslraedtavyycakytsppqnhgfdywgqgtlvtv
>d4u3xc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqllesggglggslrlscaasgfrfdaedmgwvrqalewvssiygpsgstyyadsvkgrf tisrdnskntlylqmnslraedtavyycakytsppqnhgfdywgqgtlvtv
Timeline for d4u3xc_: