SCOPe 2.05: Domain d4s1df2: 4s1d F:108-213

Lineage for d4s1df2 (4s1d F:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4s1df2: 4s1d F:108-213 [269900]
   Other proteins in same PDB: d4s1dd1, d4s1df1, d4s1dl1, d4s1dp1
   automated match to d1h3pl2
   complexed with 41m, so4

Details for d4s1df2

PDB Entry: 4s1d, 2.5 Å

PDB Description: structure of igg1 fab fragment in complex with biotincytidinamide

PDB Compounds: (F:) MAB M33 FAB FRAGMENT, light chain

SCOPe Domain Sequences for d4s1df2:

Sequence; same for both SEQRES and ATOM records:

>d4s1df2 b.1.1.2 (F:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4s1df2:

• d4s1df2 is new in SCOPe 2.05-stable
  
• d4s1df2 appears in SCOPe 2.06
  
• d4s1df2 appears in the current release, SCOPe 2.08