SCOPe 2.05: Domain d4rxka_: 4rxk A:

Lineage for d4rxka_ (4rxk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Actinomadura melliaura [TaxId:360723] [269170] (3 PDB entries)

8. Domain d4rxka_: 4rxk A: [269885]
   automated match to d1mdoa_
   complexed with gol, plp

Details for d4rxka_

PDB Entry: 4rxk, 1.5 Å

PDB Description: crystal structure of putative aminotransferase fromactinomadura melliaura in the complex with pyridoxal 5'-phosphate

PDB Compounds: (A:) Putative aminotransferase

SCOPe Domain Sequences for d4rxka_:

Sequence; same for both SEQRES and ATOM records:

>d4rxka_ c.67.1.0 (A:) automated matches {Actinomadura melliaura [TaxId: 360723]}
amiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsglc
lalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkispa
traiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgnmc
vfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwhmt
dlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkvdd
rpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdre
hvvatirsgw

Timeline for d4rxka_:

• d4rxka_ is new in SCOPe 2.05-stable
  
• d4rxka_ does not appear in SCOPe 2.06