SCOPe 2.05: Domain d4rvaa_: 4rva A:

Lineage for d4rvaa_ (4rva A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (47 PDB entries)

8. Domain d4rvaa_: 4rva A: [269878]
   automated match to d3cmza_
   complexed with bct; mutant

Details for d4rvaa_

PDB Entry: 4rva, 1.44 Å

PDB Description: a triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for deacylation

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d4rvaa_:

Sequence; same for both SEQRES and ATOM records:

>d4rvaa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldryygelneaipnderdttmpaamattlrklltgelltpasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d4rvaa_:

• d4rvaa_ is new in SCOPe 2.05-stable
  
• d4rvaa_ appears in SCOPe 2.06
  
• d4rvaa_ appears in the current release, SCOPe 2.08