Lineage for d4rx2b_ (4rx2 B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949540Protein beta-Lactamase, class A [56606] (16 species)
  7. 1949565Species Escherichia coli, TEM-1 [TaxId:562] [56607] (47 PDB entries)
  8. 1949621Domain d4rx2b_: 4rx2 B: [269877]
    automated match to d1fqga_
    complexed with so4; mutant

Details for d4rx2b_

PDB Entry: 4rx2 (more details), 2.31 Å

PDB Description: a triple mutant in the omega-loop of tem-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d4rx2b_:

Sequence, based on SEQRES records: (download)

>d4rx2b_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldryygelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Sequence, based on observed residues (ATOM records): (download)

>d4rx2b_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldryygnderdtttpaamattlrklltgelltlasrqqlidwme
adkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsqatmde
rnrqiaeigaslikhw

SCOPe Domain Coordinates for d4rx2b_:

Click to download the PDB-style file with coordinates for d4rx2b_.
(The format of our PDB-style files is described here.)

Timeline for d4rx2b_: