Lineage for d4rr1b2 (4rr1 B:255-361)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1786329Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 1786373Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)
  7. 1786374Species Escherichia coli [TaxId:562] [110189] (6 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 1786387Domain d4rr1b2: 4rr1 B:255-361 [269875]
    Other proteins in same PDB: d4rr1a1, d4rr1b1, d4rr1c1
    automated match to d1sota1
    complexed with ni, po4

Details for d4rr1b2

PDB Entry: 4rr1 (more details), 2.3 Å

PDB Description: re-refinement of entry 1sot, crystal structure of the degs stress sensor
PDB Compounds: (B:) Protease degS

SCOPe Domain Sequences for d4rr1b2:

Sequence, based on SEQRES records: (download)

>d4rr1b2 b.36.1.4 (B:255-361) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypatnhhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d4rr1b2 b.36.1.4 (B:255-361) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigigggivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvi
pvvvmqltlqvtiqeypatnhhhhhh

SCOPe Domain Coordinates for d4rr1b2:

Click to download the PDB-style file with coordinates for d4rr1b2.
(The format of our PDB-style files is described here.)

Timeline for d4rr1b2: