Lineage for d4rkcb_ (4rkc B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867872Species Psychrobacter sp. [TaxId:408968] [269853] (2 PDB entries)
  8. 1867874Domain d4rkcb_: 4rkc B: [269855]
    automated match to d4wd2a_
    complexed with mg, no3, pmp

Details for d4rkcb_

PDB Entry: 4rkc (more details), 2.19 Å

PDB Description: psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. b6
PDB Compounds: (B:) aromatic amino acid aminotransferase

SCOPe Domain Sequences for d4rkcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkcb_ c.67.1.0 (B:) automated matches {Psychrobacter sp. [TaxId: 408968]}
mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd

SCOPe Domain Coordinates for d4rkcb_:

Click to download the PDB-style file with coordinates for d4rkcb_.
(The format of our PDB-style files is described here.)

Timeline for d4rkcb_: