Lineage for d4r25a1 (4r25 A:10-121)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950908Species Bacillus subtilis [TaxId:224308] [269820] (2 PDB entries)
  8. 2950909Domain d4r25a1: 4r25 A:10-121 [269821]
    Other proteins in same PDB: d4r25a2
    automated match to d3lf0a_
    complexed with zn

Details for d4r25a1

PDB Entry: 4r25 (more details), 2.52 Å

PDB Description: structure of b. subtilis glnk
PDB Compounds: (A:) Nitrogen regulatory PII-like protein

SCOPe Domain Sequences for d4r25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r25a1 d.58.5.0 (A:10-121) automated matches {Bacillus subtilis [TaxId: 224308]}
mfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkahtelyrgvkiesnvyerlk
ieivvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal

SCOPe Domain Coordinates for d4r25a1:

Click to download the PDB-style file with coordinates for d4r25a1.
(The format of our PDB-style files is described here.)

Timeline for d4r25a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r25a2