SCOPe 2.06: Domain d4qkhb1: 4qkh B:72-191

Lineage for d4qkhb1 (4qkh B:72-191)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d4qkhb1: 4qkh B:72-191 [269809]
   Other proteins in same PDB: d4qkha2, d4qkha3, d4qkhb2
   automated match to d3rs1a_
   complexed with nag

Details for d4qkhb1

PDB Entry: 4qkh, 1.8 Å

PDB Description: dimeric form of human llt1, a ligand for nkr-p1

PDB Compounds: (B:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d4qkhb1:

Sequence; same for both SEQRES and ATOM records:

>d4qkhb1 d.169.1.0 (B:72-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdh
wiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdihv

Timeline for d4qkhb1:

• d4qkhb1 first appeared in SCOPe 2.05, called d4qkhb_
  
• d4qkhb1 appears in SCOPe 2.07
  
• d4qkhb1 appears in the current release, SCOPe 2.08