SCOPe 2.05: Domain d4qkhb_: 4qkh B:

Lineage for d4qkhb_ (4qkh B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (13 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (22 PDB entries)

8. Domain d4qkhb_: 4qkh B: [269809]
   automated match to d3rs1a_
   complexed with nag

Details for d4qkhb_

PDB Entry: 4qkh, 1.8 Å

PDB Description: dimeric form of human llt1, a ligand for nkr-p1

PDB Compounds: (B:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d4qkhb_:

Sequence; same for both SEQRES and ATOM records:

>d4qkhb_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdh
wiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdihv
g

Timeline for d4qkhb_:

• d4qkhb_ is new in SCOPe 2.05-stable
  
• d4qkhb_ is called d4qkhb1 in SCOPe 2.06
  
• d4qkhb_ appears in the current release, SCOPe 2.08, called d4qkhb1