SCOPe 2.06: Domain d4qcid_: 4qci D:

Lineage for d4qcid_ (4qci D:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein automated matches [190290] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)

8. Domain d4qcid_: 4qci D: [269801]
   Other proteins in same PDB: d4qcia1, d4qcia2, d4qcil1, d4qcil2
   automated match to d3mjgb_

Details for d4qcid_

PDB Entry: 4qci, 2.3 Å

PDB Description: pdgf-b blocking antibody bound to pdgf-bb

PDB Compounds: (D:) Platelet-derived growth factor subunit B

SCOPe Domain Sequences for d4qcid_:

Sequence; same for both SEQRES and ATOM records:

>d4qcid_ g.17.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iaepamiaecktrtevfeisrrlidrtnanflvwppcvevqrcsgccnnrnvqcrptqvq
lrpvqvrkieivrkkpifkkatvtledhlackcetv

Timeline for d4qcid_:

• d4qcid_ first appeared in SCOPe 2.05
  
• d4qcid_ appears in SCOPe 2.07
  
• d4qcid_ appears in the current release, SCOPe 2.08