Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (716 PDB entries) Uniprot P00698 |
Domain d4pgjb_: 4pgj B: [269759] Other proteins in same PDB: d4pgja_, d4pgjc_ automated match to d3lzta_ |
PDB Entry: 4pgj (more details), 2.6 Å
SCOPe Domain Sequences for d4pgjb_:
Sequence, based on SEQRES records: (download)
>d4pgjb_ d.2.1.2 (B:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcr
>d4pgjb_ d.2.1.2 (B:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdngmnawvawrnrckgtdvq awirgcr
Timeline for d4pgjb_: