SCOPe 2.08: Domain d4p3pa1: 4p3p A:242-532

Lineage for d4p3pa1 (4p3p A:242-532)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein automated matches [193659] (8 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries)

8. Domain d4p3pa1: 4p3p A:242-532 [269733]
   Other proteins in same PDB: d4p3pa2, d4p3pb2
   automated match to d4hwra1
   protein/RNA complex; complexed with 2cr, gol, zn

Details for d4p3pa1

PDB Entry: 4p3p, 2.1 Å

PDB Description: structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 3

PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4p3pa1:

Sequence; same for both SEQRES and ATOM records:

>d4p3pa1 d.104.1.1 (A:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d4p3pa1:

• d4p3pa1 first appeared in SCOPe 2.05
  
• d4p3pa1 appears in SCOPe 2.07