Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries) |
Domain d4n6ma_: 4n6m A: [269688] automated match to d1tija_ complexed with so4 |
PDB Entry: 4n6m (more details), 2.9 Å
SCOPe Domain Sequences for d4n6ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6ma_ d.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rmvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltme mgstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm
Timeline for d4n6ma_: