Lineage for d4n6mb_ (4n6m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935898Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries)
  8. 2935907Domain d4n6mb_: 4n6m B: [269684]
    automated match to d1tija_
    complexed with so4

Details for d4n6mb_

PDB Entry: 4n6m (more details), 2.9 Å

PDB Description: crystal structure of human cystatin e/m produced in lexsy
PDB Compounds: (B:) cystatin-M

SCOPe Domain Sequences for d4n6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6mb_ d.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmem
gstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm

SCOPe Domain Coordinates for d4n6mb_:

Click to download the PDB-style file with coordinates for d4n6mb_.
(The format of our PDB-style files is described here.)

Timeline for d4n6mb_: