Lineage for d4cxmc_ (4cxm C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894932Species Plasmodium falciparum [TaxId:36329] [187826] (18 PDB entries)
  8. 2894951Domain d4cxmc_: 4cxm C: [269635]
    automated match to d2i7ca_
    complexed with mta, spd

Details for d4cxmc_

PDB Entry: 4cxm (more details), 1.75 Å

PDB Description: crystal structure of plasmodium falciparum spermidine synthase in complex with methylthioadenosin and spermidine after catalysis in crystal
PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d4cxmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cxmc_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

SCOPe Domain Coordinates for d4cxmc_:

Click to download the PDB-style file with coordinates for d4cxmc_.
(The format of our PDB-style files is described here.)

Timeline for d4cxmc_: