SCOPe 2.08: Domain d4cjna1: 4cjn A:27-138

Lineage for d4cjna1 (4cjn A:27-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256155] (6 PDB entries)

8. Domain d4cjna1: 4cjn A:27-138 [269620]
   Other proteins in same PDB: d4cjna2, d4cjna3, d4cjnb2, d4cjnb3
   automated match to d1vqqa1
   complexed with cd, cl, mur, qnz

Details for d4cjna1

PDB Entry: 4cjn, 1.95 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with quinazolinone ligand

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4cjna1:

Sequence; same for both SEQRES and ATOM records:

>d4cjna1 d.17.4.0 (A:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d4cjna1:

• d4cjna1 first appeared in SCOPe 2.05
  
• d4cjna1 appears in SCOPe 2.07