SCOPe 2.05: Domain d4x6ba2: 4x6b A:114-202

Lineage for d4x6ba2 (4x6b A:114-202)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4x6ba2: 4x6b A:114-202 [269579]
   Other proteins in same PDB: d4x6ba1, d4x6bb1, d4x6bb2, d4x6bc1, d4x6bd1, d4x6bd2
   automated match to d2pyfa2

Details for d4x6ba2

PDB Entry: 4x6b, 2.1 Å

PDB Description: bk6 tcr apo structure

PDB Compounds: (A:) tcr alpha

SCOPe Domain Sequences for d4x6ba2:

Sequence, based on SEQRES records:

>d4x6ba2 b.1.1.2 (A:114-202) automated matches {Homo sapiens [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4x6ba2 b.1.1.2 (A:114-202) automated matches {Homo sapiens [TaxId: 9606]}
iqnpdpavyqlrdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffps

Timeline for d4x6ba2:

• d4x6ba2 is new in SCOPe 2.05-stable
  
• d4x6ba2 appears in SCOPe 2.06
  
• d4x6ba2 appears in the current release, SCOPe 2.08