SCOPe 2.05: Domain d4x6ch2: 4x6c H:117-244

Lineage for d4x6ch2 (4x6c H:117-244)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4x6ch2: 4x6c H:117-244 [269573]
   Other proteins in same PDB: d4x6ca1, d4x6ca2, d4x6cb_, d4x6cc1, d4x6cd_, d4x6ce2, d4x6cg2
   automated match to d2nw2b2
   complexed with 42h, nag

Details for d4x6ch2

PDB Entry: 4x6c, 2.8 Å

PDB Description: cd1a ternary complex with lysophosphatidylcholine and bk6 tcr

PDB Compounds: (H:) tcr beta

SCOPe Domain Sequences for d4x6ch2:

Sequence; same for both SEQRES and ATOM records:

>d4x6ch2 b.1.1.0 (H:117-244) automated matches {Homo sapiens [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4x6ch2:

• d4x6ch2 is new in SCOPe 2.05-stable
  
• d4x6ch2 appears in SCOPe 2.06
  
• d4x6ch2 appears in the current release, SCOPe 2.08