Lineage for d4x6dg1 (4x6d G:2-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765092Domain d4x6dg1: 4x6d G:2-113 [269562]
    Other proteins in same PDB: d4x6da1, d4x6da2, d4x6db_, d4x6dc1, d4x6dd_, d4x6de2, d4x6dg2
    automated match to d2pyfa1
    complexed with ola, pam

Details for d4x6dg1

PDB Entry: 4x6d (more details), 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr
PDB Compounds: (G:) tcr alpha

SCOPe Domain Sequences for d4x6dg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6dg1 b.1.1.0 (G:2-113) automated matches {Homo sapiens [TaxId: 9606]}
eveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrft
aqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpn

SCOPe Domain Coordinates for d4x6dg1:

Click to download the PDB-style file with coordinates for d4x6dg1.
(The format of our PDB-style files is described here.)

Timeline for d4x6dg1: