SCOPe 2.05: Domain d4x6de1: 4x6d E:2-113

Lineage for d4x6de1 (4x6d E:2-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4x6de1: 4x6d E:2-113 [269560]
   Other proteins in same PDB: d4x6da1, d4x6da2, d4x6db_, d4x6dc1, d4x6dd_, d4x6de2, d4x6dg2
   automated match to d2pyfa1
   complexed with ola, pam

Details for d4x6de1

PDB Entry: 4x6d, 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr

PDB Compounds: (E:) tcr alpha

SCOPe Domain Sequences for d4x6de1:

Sequence; same for both SEQRES and ATOM records:

>d4x6de1 b.1.1.0 (E:2-113) automated matches {Homo sapiens [TaxId: 9606]}
eveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrft
aqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpn

Timeline for d4x6de1:

• d4x6de1 is new in SCOPe 2.05-stable
  
• d4x6de1 appears in SCOPe 2.06
  
• d4x6de1 appears in the current release, SCOPe 2.08