Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4x6cd_: 4x6c D: [269559] Other proteins in same PDB: d4x6ca1, d4x6ca2, d4x6cc1, d4x6ce1, d4x6ce2, d4x6cf1, d4x6cf2, d4x6cg1, d4x6cg2, d4x6ch1, d4x6ch2 automated match to d1k5nb_ complexed with 42h, nag |
PDB Entry: 4x6c (more details), 2.8 Å
SCOPe Domain Sequences for d4x6cd_:
Sequence, based on SEQRES records: (download)
>d4x6cd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
>d4x6cd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfyllyyt eftptekdeyacrvnhvtlsqpkivkwdrd
Timeline for d4x6cd_: