Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries) |
Domain d4wstf_: 4wst F: [269520] Other proteins in same PDB: d4wsta_, d4wstc_, d4wste_, d4wstg_, d4wsti_, d4wstk_ automated match to d4kthd_ complexed with nag |
PDB Entry: 4wst (more details), 2.4 Å
SCOPe Domain Sequences for d4wstf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wstf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 11320]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
Timeline for d4wstf_: