Lineage for d4wste_ (4wst E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778763Species Influenza A virus [TaxId:11320] [228462] (15 PDB entries)
  8. 1778772Domain d4wste_: 4wst E: [269519]
    Other proteins in same PDB: d4wstb_, d4wstd_, d4wstf_, d4wsth_, d4wstj_, d4wstl_
    automated match to d4fiua1
    complexed with nag

Details for d4wste_

PDB Entry: 4wst (more details), 2.4 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 influenza virus
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wste_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wste_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
lwigecpkyvkseslrlatglrnvp

SCOPe Domain Coordinates for d4wste_:

Click to download the PDB-style file with coordinates for d4wste_.
(The format of our PDB-style files is described here.)

Timeline for d4wste_: