Lineage for d4wsth_ (4wst H:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041691Domain d4wsth_: 4wst H: [269516]
    Other proteins in same PDB: d4wsta1, d4wsta2, d4wstc1, d4wstc2, d4wste1, d4wste2, d4wstg1, d4wstg2, d4wsti1, d4wsti2, d4wstk1, d4wstk2
    automated match to d4kthd_
    complexed with nag

Details for d4wsth_

PDB Entry: 4wst (more details), 2.4 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 influenza virus
PDB Compounds: (H:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsth_ h.3.1.1 (H:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

SCOPe Domain Coordinates for d4wsth_:

Click to download the PDB-style file with coordinates for d4wsth_.
(The format of our PDB-style files is described here.)

Timeline for d4wsth_: