SCOPe 2.05: Domain d4wstd_: 4wst D:

Lineage for d4wstd_ (4wst D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries)

8. Domain d4wstd_: 4wst D: [269513]
   Other proteins in same PDB: d4wsta_, d4wstc_, d4wste_, d4wstg_, d4wsti_, d4wstk_
   automated match to d4kthd_
   complexed with nag

Details for d4wstd_

PDB Entry: 4wst, 2.4 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 influenza virus

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wstd_:

Sequence; same for both SEQRES and ATOM records:

>d4wstd_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

Timeline for d4wstd_:

• d4wstd_ is new in SCOPe 2.05-stable
  
• d4wstd_ appears in SCOPe 2.06
  
• d4wstd_ appears in the current release, SCOPe 2.08