Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries) |
Domain d4wstb_: 4wst B: [269509] Other proteins in same PDB: d4wsta1, d4wsta2, d4wstc1, d4wstc2, d4wste1, d4wste2, d4wstg1, d4wstg2, d4wsti1, d4wsti2, d4wstk1, d4wstk2 automated match to d4kthd_ complexed with nag |
PDB Entry: 4wst (more details), 2.4 Å
SCOPe Domain Sequences for d4wstb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wstb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
Timeline for d4wstb_: