Lineage for d4wsxp_ (4wsx P:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041746Domain d4wsxp_: 4wsx P: [269500]
    Other proteins in same PDB: d4wsxa_, d4wsxc_, d4wsxe_, d4wsxg_, d4wsxi_, d4wsxk_, d4wsxm_, d4wsxo_, d4wsxq_, d4wsxs_, d4wsxu_, d4wsxw_
    automated match to d4d00d_
    complexed with nag

Details for d4wsxp_

PDB Entry: 4wsx (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/jiangxi-donghu/346/2013 influenza virus
PDB Compounds: (P:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsxp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsxp_ h.3.1.1 (P:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4wsxp_:

Click to download the PDB-style file with coordinates for d4wsxp_.
(The format of our PDB-style files is described here.)

Timeline for d4wsxp_: