SCOPe 2.08: Domain d4wsrf1: 4wsr F:1-322

Lineage for d4wsrf1 (4wsr F:1-322)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269456] (2 PDB entries)

8. Domain d4wsrf1: 4wsr F:1-322 [269476]
   Other proteins in same PDB: d4wsra2, d4wsrb2, d4wsrc2, d4wsrd2, d4wsre2, d4wsrf2
   automated match to d1ha0a1
   complexed with nag

Details for d4wsrf1

PDB Entry: 4wsr, 2.5 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4wsrf1:

Sequence; same for both SEQRES and ATOM records:

>d4wsrf1 b.19.1.0 (F:1-322) automated matches {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
igecpkyvkskslklatglrnv

Timeline for d4wsrf1:

• d4wsrf1 first appeared in SCOPe 2.05
  
• d4wsrf1 appears in SCOPe 2.07