Lineage for d4ue9a_ (4ue9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962784Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)
  8. 2962791Domain d4ue9a_: 4ue9 A: [269412]
    automated match to d2v8ye1

Details for d4ue9a_

PDB Entry: 4ue9 (more details), 2.15 Å

PDB Description: complex of d. melanogaster eif4e with the 4e-binding protein 4e-t
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4ue9a_:

Sequence, based on SEQRES records: (download)

>d4ue9a_ d.86.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl

Sequence, based on observed residues (ATOM records): (download)

>d4ue9a_ d.86.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrswedmqneitsfdtvedfwslynhikppseiklgsdyslfkkn
irpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinirgk
snkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvnvksiytl

SCOPe Domain Coordinates for d4ue9a_:

Click to download the PDB-style file with coordinates for d4ue9a_.
(The format of our PDB-style files is described here.)

Timeline for d4ue9a_: