Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
Protein automated matches [190708] (10 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries) |
Domain d4ueca1: 4uec A:69-236 [269406] Other proteins in same PDB: d4ueca2, d4uecc2 automated match to d2v8ye1 complexed with mgt |
PDB Entry: 4uec (more details), 2.4 Å
SCOPe Domain Sequences for d4ueca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ueca1 d.86.1.0 (A:69-236) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmv
Timeline for d4ueca1: