Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein automated matches [190110] (7 species) not a true protein |
Species Desulfovibrio fructosivorans [TaxId:878] [269393] (3 PDB entries) |
Domain d4ucwb_: 4ucw B: [269397] Other proteins in same PDB: d4ucwq_, d4ucwr_, d4ucws_ automated match to d4urhc_ complexed with f3s, fco, gol, mg, ni, sf4; mutant |
PDB Entry: 4ucw (more details), 2.3 Å
SCOPe Domain Sequences for d4ucwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ucwb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosivorans [TaxId: 878]} hrpsvvwlhnaecvgcteaairtikpyidalildtisldyqetimaaageaaeaalhqal egkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqkak pnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelvh dncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqaghp clgcsepdfwdtmtpfyeqg
Timeline for d4ucwb_: