Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries) |
Domain d4s0td_: 4s0t D: [269368] Other proteins in same PDB: d4s0ta_, d4s0tb_ automated match to d4ov6f_ complexed with 40u |
PDB Entry: 4s0t (more details), 3.14 Å
SCOPe Domain Sequences for d4s0td_:
Sequence, based on SEQRES records: (download)
>d4s0td_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk pgvdytitvyaemypgspwagqvmdiqpisinyrt
>d4s0td_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk pgvdytitvyaemypgspwmdiqpisinyrt
Timeline for d4s0td_: