Lineage for d4qtiu3 (4qti U:188-277)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032435Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 3032436Species Human (Homo sapiens) [TaxId:9606] [161129] (7 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 3032484Domain d4qtiu3: 4qti U:188-277 [269329]
    Other proteins in same PDB: d4qtih1, d4qtih2, d4qtil1, d4qtil2
    automated match to d2i9be1

Details for d4qtiu3

PDB Entry: 4qti (more details), 3 Å

PDB Description: crystal structure of human upar in complex with anti-upar fab 8b12
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d4qtiu3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qtiu3 g.7.1.3 (U:188-277) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
pqngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmc
qhahlgdafsmnhidvscctksgcnhpdld

SCOPe Domain Coordinates for d4qtiu3:

Click to download the PDB-style file with coordinates for d4qtiu3.
(The format of our PDB-style files is described here.)

Timeline for d4qtiu3: