Class g: Small proteins [56992] (94 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species) duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6 |
Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries) Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108 |
Domain d4qtiu1: 4qti U:1-80 [269327] Other proteins in same PDB: d4qtil1, d4qtil2 automated match to d2i9be2 |
PDB Entry: 4qti (more details), 3 Å
SCOPe Domain Sequences for d4qtiu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qtiu1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]} lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg lkitsltevvcgldlcnqgn
Timeline for d4qtiu1: