Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Staphylococcus aureus [TaxId:1458279] [269318] (1 PDB entry) |
Domain d4qrhd_: 4qrh D: [269322] automated match to d2j41d_ complexed with 0o2, edo, k, mg, so4 |
PDB Entry: 4qrh (more details), 1.65 Å
SCOPe Domain Sequences for d4qrhd_:
Sequence, based on SEQRES records: (download)
>d4qrhd_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1458279]} nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi flappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqc iveaehlkrerveakyrk
>d4qrhd_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1458279]} nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi flappslehliqsrinearkevemmnlydyvvvndevelaknriqciveaehlkrervea kyrk
Timeline for d4qrhd_: