Lineage for d4qrhd_ (4qrh D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872861Species Staphylococcus aureus [TaxId:1458279] [269318] (1 PDB entry)
  8. 2872865Domain d4qrhd_: 4qrh D: [269322]
    automated match to d2j41d_
    complexed with 0o2, edo, k, mg, so4

Details for d4qrhd_

PDB Entry: 4qrh (more details), 1.65 Å

PDB Description: molecular mechanism and evolution of guanylate kinase regulation by (p)ppgpp
PDB Compounds: (D:) Guanylate kinase

SCOPe Domain Sequences for d4qrhd_:

Sequence, based on SEQRES records: (download)

>d4qrhd_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
flappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqc
iveaehlkrerveakyrk

Sequence, based on observed residues (ATOM records): (download)

>d4qrhd_ c.37.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
flappslehliqsrinearkevemmnlydyvvvndevelaknriqciveaehlkrervea
kyrk

SCOPe Domain Coordinates for d4qrhd_:

Click to download the PDB-style file with coordinates for d4qrhd_.
(The format of our PDB-style files is described here.)

Timeline for d4qrhd_: