Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (15 species) not a true protein |
Species Influenza A virus [TaxId:641501] [189475] (6 PDB entries) |
Domain d4qnpb_: 4qnp B: [269290] Other proteins in same PDB: d4qnpf1, d4qnpf2, d4qnpl1, d4qnpl2 automated match to d3ti4a_ complexed with ca, nag |
PDB Entry: 4qnp (more details), 2.8 Å
SCOPe Domain Sequences for d4qnpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qnpb_ b.68.1.0 (B:) automated matches {Influenza A virus [TaxId: 641501]} svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs sisfcgvnsdtvgwswpdgaelpfti
Timeline for d4qnpb_: