Lineage for d4qlyd_ (4qly D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963502Species Lactobacillus plantarum [TaxId:1590] [269281] (2 PDB entries)
  8. 2963508Domain d4qlyd_: 4qly D: [269282]
    automated match to d3gbha_
    complexed with fmn

Details for d4qlyd_

PDB Entry: 4qly (more details), 2 Å

PDB Description: crystal structure of cla-er, a novel enone reductase catalyzing a key step of a gut-bacterial fatty acid saturation metabolism, biohydrogenation
PDB Compounds: (D:) Enone reductase CLA-ER

SCOPe Domain Sequences for d4qlyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlyd_ d.90.1.0 (D:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
lvnndladvmfnrhsvrqfdpnvkigrdelqkmiaeaatapsacnlqswhfvvvdtpeak
akfkqavmkfnypqvdsasaivfiagdtqshyvyrdvwnkvyedgnitkerldqilgtfl
plyenatpdflkfdatidcsvvgmqlllvarahgydanafsgidfekmiptlgldpkryv
pvmgiaigkaaqeplhttrydaktqtdfla

SCOPe Domain Coordinates for d4qlyd_:

Click to download the PDB-style file with coordinates for d4qlyd_.
(The format of our PDB-style files is described here.)

Timeline for d4qlyd_: