Lineage for d4qifd_ (4qif D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2956023Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2956024Protein automated matches [195117] (13 species)
    not a true protein
  7. 2956128Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries)
  8. 2956132Domain d4qifd_: 4qif D: [269275]
    Other proteins in same PDB: d4qifh2
    automated match to d2a10f_
    complexed with gol, k, pgo, so4, tar; mutant

Details for d4qifd_

PDB Entry: 4qif (more details), 2 Å

PDB Description: crystal structure of pdua with edge mutation k26a and pore mutation s40h
PDB Compounds: (D:) Propanediol utilization protein pduA

SCOPe Domain Sequences for d4qifd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qifd_ d.58.56.0 (D:) automated matches {Salmonella enterica [TaxId: 99287]}
qealgmvetkgltaaieaadamvasanvmlvgyekighglvtvivrgdvgavkaatdaga
aaarnvgevkavhviprphtdvekilpk

SCOPe Domain Coordinates for d4qifd_:

Click to download the PDB-style file with coordinates for d4qifd_.
(The format of our PDB-style files is described here.)

Timeline for d4qifd_: