Lineage for d2napa1 (2nap A:601-723)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 804836Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 804878Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 804902Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 804945Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)
  7. 804946Species Desulfovibrio desulfuricans [TaxId:876] [50707] (8 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 804949Domain d2napa1: 2nap A:601-723 [26926]
    Other proteins in same PDB: d2napa2
    complexed with fs4, mes, mgd, mo

Details for d2napa1

PDB Entry: 2nap (more details), 1.9 Å

PDB Description: dissimilatory nitrate reductase (nap) from desulfovibrio desulfuricans
PDB Compounds: (A:) protein (periplasmic nitrate reductase)

SCOP Domain Sequences for d2napa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2napa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOP Domain Coordinates for d2napa1:

Click to download the PDB-style file with coordinates for d2napa1.
(The format of our PDB-style files is described here.)

Timeline for d2napa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2napa2