Lineage for d1g8jc1 (1g8j C:683-825)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377990Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 378013Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 378034Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (8 proteins)
    molybdopterine enzyme
  6. 378035Protein Arsenite oxidase large subunit [50704] (1 species)
  7. 378036Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)
  8. 378042Domain d1g8jc1: 1g8j C:683-825 [26925]
    Other proteins in same PDB: d1g8ja2, d1g8jb_, d1g8jc2, d1g8jd_
    complexed with 4mo, fes, fs3, mgd, oxo

Details for d1g8jc1

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8jc1 b.52.2.2 (C:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

SCOP Domain Coordinates for d1g8jc1:

Click to download the PDB-style file with coordinates for d1g8jc1.
(The format of our PDB-style files is described here.)

Timeline for d1g8jc1: