Lineage for d1g8jc1 (1g8j C:683-825)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 16157Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 16163Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)
  6. Protein Arsenite oxidase large subunit [50704] (1 species)
  7. Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)
  8. Domain d1g8jc1: 1g8j C:683-825 [26925]
    Other proteins in same PDB: d1g8ja2, d1g8jb_, d1g8jc2, d1g8jd_

Details for d1g8jc1

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8jc1 b.52.2.2 (C:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

SCOP Domain Coordinates for d1g8jc1 are not available.

Timeline for d1g8jc1:

Domains from same chain:
(mouse over for more information)
d1g8jc2
Domains from other chains:
(mouse over for more information)
d1g8ja1, d1g8ja2, d1g8jb_, d1g8jd_