Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Vibrio cholerae [TaxId:686] [269225] (1 PDB entry) |
Domain d4xoxa2: 4xox A:250-403 [269229] Other proteins in same PDB: d4xoxa3, d4xoxb3 automated match to d3mqda2 |
PDB Entry: 4xox (more details), 2.01 Å
SCOPe Domain Sequences for d4xoxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xoxa2 c.95.1.0 (A:250-403) automated matches {Vibrio cholerae [TaxId: 686]} kiygeivgygatsdgydmvapsgegaircmkmamqgvdkidyinthgtstpvgdvkelga iqevfggnspaisatkamtghalgaagvheaiystlmlhhgfiapsinidtldeaaqgld ivtelreqelttvmsnsfgfggtnatlvikkyqg
Timeline for d4xoxa2: