Lineage for d4xlta_ (4xlt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838162Species Dyadobacter fermentans [TaxId:471854] [269223] (1 PDB entry)
  8. 1838163Domain d4xlta_: 4xlt A: [269224]
    automated match to d1k66a_

Details for d4xlta_

PDB Entry: 4xlt (more details), 2.3 Å

PDB Description: Crystal structure of response regulator receiver protein from Dyadobacter fermentans DSM 18053
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d4xlta_:

Sequence, based on SEQRES records: (download)

>d4xlta_ c.23.1.0 (A:) automated matches {Dyadobacter fermentans [TaxId: 471854]}
amdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlq
mpgingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipll
rellkrwfps

Sequence, based on observed residues (ATOM records): (download)

>d4xlta_ c.23.1.0 (A:) automated matches {Dyadobacter fermentans [TaxId: 471854]}
amdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlq
mingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipllre
llkrwfps

SCOPe Domain Coordinates for d4xlta_:

Click to download the PDB-style file with coordinates for d4xlta_.
(The format of our PDB-style files is described here.)

Timeline for d4xlta_:

  • d4xlta_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-20
  • d4xlta_ is called d4xlta1 in SCOPe 2.06
  • d4xlta_ appears in the current release, SCOPe 2.07, called d4xlta1