Lineage for d1g8ka1 (1g8k A:683-825)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
Superfamily b.52.2: ADC-like [50692] (4 families) 
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
molybdopterine enzyme
Protein Arsenite oxidase large subunit [50704] (1 species) Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries) 
Domain d1g8ka1: 1g8k A:683-825 [26920]
Other proteins in same PDB: d1g8ka2, d1g8kb_, d1g8kc2, d1g8kd_, d1g8ke2, d1g8kf_, d1g8kg2, d1g8kh_
complexed with 4mo, ca, edo, f3s, fes, hg, mgd, o
Details for d1g8ka1
PDB Entry: 1g8k (more details), 1.64 Å
PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
PDB Compounds: (A:) arsenite oxidaseSCOPe Domain Sequences for d1g8ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg
SCOPe Domain Coordinates for d1g8ka1:
Click to download the PDB-style file with coordinates for d1g8ka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g8ka1:
View in 3D
