Lineage for d1g8ka1 (1g8k A:683-825)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 16157Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 16163Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)
  6. Protein Arsenite oxidase large subunit [50704] (1 species)
  7. Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)
  8. Domain d1g8ka1: 1g8k A:683-825 [26920]
    Other proteins in same PDB: d1g8ka2, d1g8kb_, d1g8kc2, d1g8kd_, d1g8ke2, d1g8kf_, d1g8kg2, d1g8kh_

Details for d1g8ka1

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

SCOP Domain Coordinates for d1g8ka1 are not available.

Timeline for d1g8ka1:

Domains from same chain:
(mouse over for more information)
d1g8ka2
Domains from other chains:
(mouse over for more information)
d1g8kb_, d1g8kc1, d1g8kc2, d1g8kd_, d1g8ke1, d1g8ke2, d1g8kf_, d1g8kg1, d1g8kg2, d1g8kh_